Search Results - (Author, Cooperation:S. L. Schreiber)
-
1J. Kronke ; N. D. Udeshi ; A. Narla ; P. Grauman ; S. N. Hurst ; M. McConkey ; T. Svinkina ; D. Heckl ; E. Comer ; X. Li ; C. Ciarlo ; E. Hartman ; N. Munshi ; M. Schenone ; S. L. Schreiber ; S. A. Carr ; B. L. Ebert
American Association for the Advancement of Science (AAAS)
Published 2013Staff ViewPublication Date: 2013-12-03Publisher: American Association for the Advancement of Science (AAAS)Print ISSN: 0036-8075Electronic ISSN: 1095-9203Topics: BiologyChemistry and PharmacologyComputer ScienceMedicineNatural Sciences in GeneralPhysicsKeywords: Antineoplastic Agents/*pharmacology ; Cell Line, Tumor ; HEK293 Cells ; Humans ; Ikaros Transcription Factor/genetics/*metabolism ; Interleukin-2/biosynthesis ; Multiple Myeloma/*metabolism ; Proteolysis ; T-Lymphocytes/drug effects/metabolism ; Thalidomide/*analogs & derivatives/pharmacology ; UbiquitinationPublished by: -
2L. Raj ; T. Ide ; A. U. Gurkar ; M. Foley ; M. Schenone ; X. Li ; N. J. Tolliday ; T. R. Golub ; S. A. Carr ; A. F. Shamji ; A. M. Stern ; A. Mandinova ; S. L. Schreiber ; S. W. Lee
Nature Publishing Group (NPG)
Published 2015Staff ViewPublication Date: 2015-09-17Publisher: Nature Publishing Group (NPG)Print ISSN: 0028-0836Electronic ISSN: 1476-4687Topics: BiologyChemistry and PharmacologyMedicineNatural Sciences in GeneralPhysicsPublished by: -
3L. Raj ; T. Ide ; A. U. Gurkar ; M. Foley ; M. Schenone ; X. Li ; N. J. Tolliday ; T. R. Golub ; S. A. Carr ; A. F. Shamji ; A. M. Stern ; A. Mandinova ; S. L. Schreiber ; S. W. Lee
Nature Publishing Group (NPG)
Published 2011Staff ViewPublication Date: 2011-07-15Publisher: Nature Publishing Group (NPG)Print ISSN: 0028-0836Electronic ISSN: 1476-4687Topics: BiologyChemistry and PharmacologyMedicineNatural Sciences in GeneralPhysicsKeywords: Animals ; Apoptosis/*drug effects ; Breast Neoplasms/*drug therapy/genetics/metabolism/*pathology ; Cell Line ; Cell Line, Tumor ; Cell Transformation, Neoplastic ; Comet Assay ; DNA Damage/drug effects ; Dioxolanes/adverse effects/chemistry/*pharmacology ; Genotype ; Mice ; Neoplasm Metastasis/drug therapy/pathology ; Oxidative Stress/*drug effects ; Reactive Oxygen Species/*metabolism ; Small Molecule Libraries/chemistry ; Xenograft Model Antitumor AssaysPublished by: -
4Staff View
ISSN: 1573-4943Keywords: Calf thymus ; FK506-binding protein ; rapamycin-binding protein ; circular dichroism ; sequence of bovine FKBPSource: Springer Online Journal Archives 1860-2000Topics: Chemistry and PharmacologyNotes: Abstract FKBP, an 11.8 kD intracellular protein that binds the immunosuppressants FK506 (K d=0.4 nM) and rapamycin (K d=0.2 nM) with high affinity, was purified to homogeneity from calf thymus. The complete amino acid sequence has been determined by automated Edman degradation of the intact molecule and overlapping fragments generated by proteolytic and chemical cleavage. The analysis revealed a 107 amino acid peptide chain with the following sequence: GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE. The molecular weight, calculated from the amino sequence to be 11,778 D, was confirmed by electrospray ionization mass spectrometry. Thus, naturally isolated bovine FKBP does not appear to have any residues modified by glycosylation, phosphorylation, or other post-translational derivatization processes. Bovine FKBP has only three amino acid residues that differ from human FKBP, whose sequence was elucidated by cloning and sequencing complementary DNA (Standaertet al., 1990). The protein has a substantial number of hydrophilic peptide segments with prevalent β-strand type of chain fold. Understanding the biological function of FKBP and other members of the immunophilin class and their respective complexes with immunosuppressive drugs may provide insights into cytoplasmic signalling mechanisms, protein folding and translocation, and other cellular processes.Type of Medium: Electronic ResourceURL: