Search Results - (Author, Cooperation:J. Davoust)
-
1R. Ravindran ; N. Khan ; H. I. Nakaya ; S. Li ; J. Loebbermann ; M. S. Maddur ; Y. Park ; D. P. Jones ; P. Chappert ; J. Davoust ; D. S. Weiss ; H. W. Virgin ; D. Ron ; B. Pulendran
American Association for the Advancement of Science (AAAS)
Published 2013Staff ViewPublication Date: 2013-12-07Publisher: American Association for the Advancement of Science (AAAS)Print ISSN: 0036-8075Electronic ISSN: 1095-9203Topics: BiologyChemistry and PharmacologyComputer ScienceMedicineNatural Sciences in GeneralPhysicsKeywords: Animals ; *Antigen Presentation ; CD4-Positive T-Lymphocytes/immunology ; CD8-Positive T-Lymphocytes/immunology ; Cell Line ; Cricetinae ; Dendritic Cells/enzymology/*immunology ; Enzyme Activation ; Humans ; Mice ; Mice, Inbred C57BL ; Mice, Mutant Strains ; Microtubule-Associated Proteins/genetics ; Protein-Serine-Threonine Kinases/*biosynthesis/genetics ; Yellow Fever Vaccine/*immunologyPublished by: -
2Staff View
ISSN: 0005-2736Keywords: ESR ; Lipid-protein interaction ; Protein-protein-interaction ; Rhodopsin ; Saturation transfer spectroscopySource: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyChemistry and PharmacologyMedicinePhysicsType of Medium: Electronic ResourceURL: -
3Staff View
ISSN: 0005-2736Keywords: (Rod outer segment) ; Boundary lipid ; ESR ; Lipid-protein interaction ; Spin labelSource: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyChemistry and PharmacologyMedicinePhysicsType of Medium: Electronic ResourceURL: -
4Staff View
ISSN: 0962-8924Source: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyMedicineType of Medium: Electronic ResourceURL: -
5Staff View
ISSN: 0014-4827Source: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyMedicineType of Medium: Electronic ResourceURL: -
6Staff View
ISSN: 0022-2364Source: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: PhysicsType of Medium: Electronic ResourceURL: -
7Staff View
ISSN: 0014-5793Source: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyChemistry and PharmacologyPhysicsType of Medium: Electronic ResourceURL: -
8Davoust, J. ; Humbert, M. ; Jouans, O. ; Raposo, G. ; Reggio, H. ; Salamero, J.
Amsterdam : ElsevierStaff ViewISSN: 0248-4900Source: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyType of Medium: Electronic ResourceURL: -
9Staff View
ISSN: 0248-4900Keywords: adenocarcinoma cells ; confocal laser scanning microscopy ; intercellular cysts ; intracellular lumensSource: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyType of Medium: Electronic ResourceURL: -
10Staff View
ISSN: 0300-9084Keywords: [abr] (0,2)PC[^1^4N]; 1-palmitoyl 2-(3-doxylpentanoly) ; [abr] (1,14)FA [^1^5N]; 16-doxylstearic acid [^1^5N] ; [abr] (1,14)MSL[^1^5N]; N-(2-hydroxyethyl) maleimide ester of ; [abr] (1,14)PC[^1^4N]; 1-palmitoyl 2-(16-doxylstearoyl) ; [abr] ESR; electron spin resonance ; [abr] PDPC; 1-palmitoyl 2-dihydrosterculoyl phosphatidylcholine ; diffusion laterale des lipides ; electron spin resonance ; interactions lipidesproteines ; interactions spin-spin ; lipid lateral diffusion ; protein-lipid interactions ; resonance paramagnetique electronique ; spin-spin interactionsSource: Elsevier Journal Backfiles on ScienceDirect 1907 - 2002Topics: BiologyChemistry and PharmacologyType of Medium: Electronic ResourceURL: -
11Amigorena, S. ; Salamero, J. ; Davoust, J. ; Fridman, W. H. ; Bonnerot, C.
[s.l.] : Nature Publishing Group
Published 1992Staff ViewISSN: 1476-4687Source: Nature Archives 1869 - 2009Topics: BiologyChemistry and PharmacologyMedicineNatural Sciences in GeneralPhysicsNotes: [Auszug] TABLE 1 cDNA sequence and FcyR expression in IIA1.6-transfected cells cDNA Sequence Transfectant cells Number of receptors per cell (xlO4) /Sell FcyRIII (a,y2) 2.8 4 FcyRIII (act4,y2) 1.4 Fc-yRllb2 KKKQVPNPPDLEEAAKTEAENTITYSLLKHPEALDEETEHDYQNHI ...Type of Medium: Electronic ResourceURL: